PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG023300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 236aa    MW: 25442.3 Da    PI: 10.5679
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG023300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-18124178256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++t+ q   Le+ F+ ++ +s+ e++eLA++++L+ rqV vWFqNrRa+ k
  Pavir.1NG023300.1.p 124 RKKLRLTAAQAAMLEDSFRAHNILSHGEKQELARRVELSARQVEVWFQNRRARTK 178
                          678899***********************************************98 PP

2HD-ZIP_I/II1101.7e-35124211188
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                          +kk+rl++ q+++LE+sF++++ L++ +K+elar+++l++rqv+vWFqnrRARtk+kq+E+d+e L+r++d+l++en+rL+++ + Lr
  Pavir.1NG023300.1.p 124 RKKLRLTAAQAAMLEDSFRAHNILSHGEKQELARRVELSARQVEVWFQNRRARTKLKQTEVDCELLRRWCDRLTDENARLRRDLAGLR 211
                          69*********************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.649120180IPR001356Homeobox domain
SMARTSM003895.0E-13122184IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.8E-17122183IPR009057Homeodomain-like
SuperFamilySSF466891.3E-17123189IPR009057Homeodomain-like
CDDcd000864.20E-11124181No hitNo description
PfamPF000461.2E-15124178IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
PfamPF021837.6E-8180212IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.7E-13180223IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MSSLTTAGSS EEHHHSVSAE EFGAHLSLGI GGGGRRTARP RTVQLFGEVL SLQDDGGPAG  60
ERHREQPTAA PAGRKRRDRT GSGTAAVAAA SRQQNKKARK VQDADDDDGD RRSLTSGGGG  120
GAGRKKLRLT AAQAAMLEDS FRAHNILSHG EKQELARRVE LSARQVEVWF QNRRARTKLK  180
QTEVDCELLR RWCDRLTDEN ARLRRDLAGL RGASARLAVC ASCCDKHQVA AGEMA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172180RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.147241e-32root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951890.12e-94PREDICTED: putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX62e-50HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLK3YVK92e-94K3YVK9_SETIT; Uncharacterized protein
STRINGSi018305m6e-94(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-26HD-ZIP family protein